zainsinghqureshi zainsinghqureshi
  • 12-01-2021
  • Mathematics
contestada

Write the ratios in simplest form.
8/64
4:20
28/36
28 to 4
16:48

oh yes and pls lmk the steps

Respuesta :

reguser315
reguser315 reguser315
  • 13-01-2021
You have to find the greatest common factor of each and divide both:

8/64=1/8 (I.e, divide both the numerator and denominator by 8)
4:20=1:5
28/36=7/9
28 to 4=7 to 1
16:48=1:3
Answer Link

Otras preguntas

which organ of the man or female reproductive system secreats fluids on the vagina
Which of the following BEST explains the reason for the Sunni/Shi'a split in Islam?
What is the effect of federalism on state governments?​ Q15 U2 TVA Gov 9.C/9.B/8.H Group of answer choices State governments rule on federal matters. State gove
The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein
HELP PLZ RN<3 which graph displays a rate of change of 2.5?
How does the information in the NASA article best add to a reader’s understanding of Team Moon? A. It gives the reader a better sense of the complex problem so
(x²+14+49)m²=what is the answer?​
flies carry many diseases​
Who Wants Brainlest But if you want it you have to do something
10 multiply by 9 1/2​